PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002338-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 814aa    MW: 89105.5 Da    PI: 7.1336
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002338-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix54.82.5e-17183271186
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkm....rergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                    +W+++ + +L++a++e+  +l+rg+l++ +Weevs+ +     +++  +s +qCk+k +nl+kryk +++++++   +s+s++p+f+++e
  NNU_002338-RA 183 EWSDSAIGCLLDAYTEKFVQLNRGNLRGRDWEEVSSIVsdrcDKTKSFKSVEQCKNKVDNLKKRYKVERHRMSSS-GTSVSHWPWFKKME 271
                    5*********************************998887777888889***********************995.88889********8 PP

2ZF-HD_dimer889.3e-28371425459
    ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     +Y+eClkNhA+ +Ggh+vD CgEfm+  geegt +alkCaA +CHRnFHR+e+e 
  NNU_002338-RA 371 SKYRECLKNHAVGIGGHVVDECGEFMAV-GEEGTLDALKCAAYNCHRNFHRKETEG 425
                    68*************************9.999*********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.2E-20181273No hitNo description
ProDomPD1257744.0E-21371424IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.2E-25372423IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.2E-26372422IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.431373422IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.6E-29471543IPR009057Homeodomain-like
SuperFamilySSF466893.4E-17472543IPR009057Homeodomain-like
TIGRFAMsTIGR015651.4E-22482538IPR006455Homeodomain, ZF-HD class
Gene3DG3DSA:3.40.1160.107.4E-74569807IPR001048Aspartate/glutamate/uridylate kinase
HamapMF_01220_B34.336572808IPR015963Uridylate kinase, bacteria
SuperFamilySSF536335.37E-59573807IPR001048Aspartate/glutamate/uridylate kinase
CDDcd042545.88E-124575808No hitNo description
TIGRFAMsTIGR020752.8E-73575807IPR015963Uridylate kinase, bacteria
PfamPF006962.3E-26576787IPR001048Aspartate/glutamate/uridylate kinase
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006221Biological Processpyrimidine nucleotide biosynthetic process
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0033862Molecular FunctionUMP kinase activity
Sequence ? help Back to Top
Protein Sequence    Length: 814 aa     Download sequence    Send to blast
MASCEDDFSI LGDENQAPPH PSHHPQSFAS HRFAGKSTPI HSHAQAPPPQ THPLNTLGAA  60
GGAGGGSPKK VGGAAAGDDE DEADDYSDAA FCSQTDSKCA PSFHDVNPNC FPAEDDTNPF  120
AAEEEPDPNK ARANTVRNEK RKDRDELSDS GTPYGFKKSK PGGGAGSGAG TSCGGDYRKD  180
REEWSDSAIG CLLDAYTEKF VQLNRGNLRG RDWEEVSSIV SDRCDKTKSF KSVEQCKNKV  240
DNLKKRYKVE RHRMSSSGTS VSHWPWFKKM EQIVGNSSKA VSDEDRPVGA PANMLRQSKR  300
VFDIAAPSCG KQNKFDKKEE KRNMEFDDHE EQDEEMGIPV SATYDSLGNS SKAKMVSAAS  360
DAASSGRRTV SKYRECLKNH AVGIGGHVVD ECGEFMAVGE EGTLDALKCA AYNCHRNFHR  420
KETEGDAYHH QFSPYCRTLV GYLHVAPHHR PLALPSTSGG GVHSWEDQED VLNPSGGGEV  480
SKKRFRTKFT LEQKDXMLAF AERLGWRIQK HDEAAMQQFC TETCVKRHVL KVWMHNNKHT  540
LEKVVILLDR YVSTPSPVGL GNNLKSKSLS NPRWRRVVFK ISGAALAGNG PQNIDPKVIM  600
MIAREVATAC HLGVEVAIVI GGRNFFCGDT WVTATGLDRS TAYQIGMMAT VMNSILLQSA  660
LEKLGIQTRI QSTFPVQEVI EPYNRKRAVR HLEKGRVVIF GGIGAGTGNP LFTTDTAAAL  720
RASEINAEAV LKGTHVDGVY DCHRSNNNNV AFEHISFREL TSRGITAMDL MAITFCEENG  780
IPVVVFNLHE PSNISRALCG DQVGTLIDQT GRIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ek5_A3e-635668071239Uridylate kinase
3ek5_B3e-635668071239Uridylate kinase
3ek5_C3e-635668071239Uridylate kinase
3ek5_D3e-635668071239Uridylate kinase
3ek5_E3e-635668071239Uridylate kinase
3ek5_F3e-635668071239Uridylate kinase
3ek6_A3e-635668071239Uridylate kinase
3ek6_B3e-635668071239Uridylate kinase
3ek6_C3e-635668071239Uridylate kinase
3ek6_D3e-635668071239Uridylate kinase
3ek6_E3e-635668071239Uridylate kinase
3ek6_F3e-635668071239Uridylate kinase
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010243329.10.0PREDICTED: uncharacterized protein LOC104587412 isoform X1
TrEMBLF6HKF71e-154F6HKF7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g04160.t011e-153(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10030.11e-128Trihelix family protein